- Recombinant Dictyostelium citrinum NADH-ubiquinone oxidoreductase chain 4L (nad4L)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1048714
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 10,544 Da
- E Coli or Yeast
- 35796
- NADH-ubiquinone oxidoreductase chain 4L (nad4L)
Sequence
MNLIDLILIAIYVIGISGLIFNKNNIINILIISELNLGTLGMLFVLASVELNDILGELSGLYILTFTAAESAIGLAIVVILYSKTGIINIRNLNKLKG